PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IHC, IP, R, WB |
Reactivities | Human |
Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PPP2R2B mouse monoclonal antibody, clone 1F3, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Rabbit polyclonal Anti-SET Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
Conjugation | FITC |
PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit. |
PP1C gamma (PPP1CC) sheep polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
PPP6C sheep polyclonal antibody, Purified
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |