Products

Jump to Filters
View as table Download
ARF1 Rabbit Polyclonal Antibody
TA346559

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA