Products

View as table Download

Rabbit Polyclonal Anti-SF3B4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE

Rabbit polyclonal anti-SF3B4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SF3B4.

Rabbit Polyclonal Anti-SF3B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP

Goat Polyclonal Antibody against SF3B4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence AAGPISERNQDAT-C, from the N Terminus of the protein sequence according to NP_005841.1.

Mouse Monoclonal SF3B4 Antibody (3A1)

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

SF3B4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SF3B4 (NP_005841.1).
Modifications Unmodified

Anti-SAP49 Antibody

Applications ICC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated