Products

View as table Download

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1. Synthetic peptide located within the following region: PRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQV

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW

OTX1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 86-116 amino acids from the Central region of human OTX1

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1. Synthetic peptide located within the following region: KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: SGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the middle region of human OTX1. Synthetic peptide located within the following region: ISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSY

OTX1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse OTX1

OTX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Otx1

OTX1/2 Rabbit polyclonal Antibody

Applications ChIP, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Otx1/2