IKZF1 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKZF1 |
IKZF1 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKZF1 |
Goat Polyclonal Antibody against IKZF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DLLRAASENSQDALR, from the internal region of the protein sequence according to NP_006051.1. |
Mouse Monoclonal Ikaros (C-terminus) Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ZNFN1A1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNFN1A1 antibody: synthetic peptide directed towards the middle region of human ZNFN1A1. Synthetic peptide located within the following region: LHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTD |
Rabbit Polyclonal anti-IKZF1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK |
Rabbit Polyclonal Anti-IKZF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: QDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASEN |
Ikzf1 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Ikzf1 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
IKZF1 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IKZF1 |
Ikaros Rabbit polyclonal Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Ikaros |