Products

View as table Download

Rabbit polyclonal anti-IL-19 Polyclonal antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant murine IL-19

Rabbit Polyclonal Anti-IL19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL19 antibody is: synthetic peptide directed towards the C-terminal region of Human IL19. Synthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE

Rabbit Polyclonal Anti-IL19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL19

IL19 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated

IL19 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL19