Products

View as table Download

Rabbit Polyclonal NALP1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1.

Rabbit Polyclonal Anti-NLRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

NLRP1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NLRP1

NLRP1 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NLRP1

NLRP1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human NLRP1 (NP_001028225.1).