Products

Jump to Filters
View as table Download
NMBR Rabbit Polyclonal Antibody
TA314264

USD 345.00

In Stock

Rabbit polyclonal anti-NMBR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NMBR.
NMBR Rabbit Polyclonal Antibody
TA344313

USD 475.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMBR antibody: synthetic peptide directed towards the N terminal of human NMBR. Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
NMBR Rabbit Polyclonal Antibody
TA384878

USD 380.00

4 Weeks

Neuromedin B Receptor Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic Peptide of NMBR