NMBR Rabbit Polyclonal Antibody

CAT#: TA344313

Rabbit Polyclonal Anti-NMBR Antibody - N-terminal region

Product Images

WB Suggested Anti-NMBR Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NMBR antibody: synthetic peptide directed towards the N terminal of human NMBR. Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: neuromedin B receptor
• Database Link:
  NP_002502
  Entrez Gene 4829 Human
  UniProt ID P28336
• Background: Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-100 AL589674.9 90178-90277 c 101-1308 M73482.1 99-1306 1309-1354 AL589674.9 77086-77131 c This locus represents an antisense transcript of the survivin locus. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 AF086186.1 11-280 271-869 AC087645.19 118062-118660 870-1098 L26245.1 740-968 1099-1286 BM839824.1 1-188 c
• Synonyms: BB1; BB1R; NMB-R
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction