Products

View as table Download

Rabbit polyclonal TPH2 (Ab-19) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19 (G-FI-SP-L-D).

Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)

Applications WB
Reactivities Human: Ser19, Mouse: Ser19, Rat: Ser19
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19.
Modifications Phospho-specific

Rabbit polyclonal TPH2 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2.

Rabbit Polyclonal Anti-TPH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2. Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS

Rabbit Anti-Tryptophan Hydroxylase (Ser19) Antibody (Phospho-Specific)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser19 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-TPH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the middle region of human TPH2. Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA

Rabbit Polyclonal Anti-TPH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TPH2

TPH2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPH2 (NP_775489.2).
Modifications Unmodified

TPH2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human TPH2 (NP_775489.2).
Modifications Unmodified