Products

Jump to Filters
View as table Download
ABCG5 Rabbit Polyclonal Antibody
TA331771

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCG5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
ABCG5 Mouse Monoclonal Antibody [Clone ID: 1B5E10]
TA336947

USD 424.00

5 Days

Mouse Monoclonal ABCG5 Antibody (1B5E10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated