Goat Polyclonal Antibody against Bradykinin receptor B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2. |
Goat Polyclonal Antibody against Bradykinin receptor B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2. |
Rabbit polyclonal anti-BDKRB1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BDKRB1. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BDKRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ |
BDKRB1 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human BDKRB1 |
BDKRB1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |