Products

View as table Download

Rabbit polyclonal anti-DGKE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKE.

DGKE rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-DGKE Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR