GGA2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGA2 |
GGA2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGA2 |
Anti-GGA2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 |
Rabbit Polyclonal Anti-GGA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GGA2 antibody is: synthetic peptide directed towards the N-terminal region of Human GGA2. Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH |
Carrier-free (glycerol/BSA-free) GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |