RALB mouse monoclonal antibody, clone 4D1, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
RALB mouse monoclonal antibody, clone 4D1, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Rabbit polyclonal antibody to RALB (v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALB (Uniprot ID#P11234) |
Rabbit polyclonal Anti-RALB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE |
Carrier-free (BSA/glycerol-free) RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-RALB Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B |
Anti-RALB Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B |
RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RALB mouse monoclonal antibody,clone 2C4, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
RALB mouse monoclonal antibody,clone 2C4, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |