Products

View as table Download

RALB mouse monoclonal antibody, clone 4D1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Rabbit polyclonal antibody to RALB (v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALB (Uniprot ID#P11234)

Rabbit polyclonal Anti-RALB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE

Carrier-free (BSA/glycerol-free) RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-RALB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B

Anti-RALB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B

RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RALB mouse monoclonal antibody,clone 2C4, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated