RALB Rabbit Polyclonal Antibody

CAT#: TA342185

Rabbit polyclonal Anti-RALB Antibody

Product Images

WB Suggested Anti-RALB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: ACHN cell lysateRALB is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RALB Ras like proto-oncogene B
• Database Link:
  NP_002872
  Entrez Gene 5899 Human
  UniProt ID P11234
• Background: This gene encodes a GTP-binding protein that belongs toThe small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediateThe transmembrane signaling initiated byThe occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008]
• Synonyms: GTP binding protein; GTP binding protein); RAS-like protein B; v-ral simian leukemia viral oncogene homolog B; v-ral simian leukemia viral oncogene homolog B (ras related
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Pancreatic cancer, Pathways in cancer