GART mouse monoclonal antibody, clone 4D6-1D5
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
GART mouse monoclonal antibody, clone 4D6-1D5
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-GART Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV |