Rabbit Polyclonal ESRRB Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB. |
Rabbit Polyclonal ESRRB Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB. |
Rabbit Polyclonal anti-ESRRB antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: RHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANG |
Rabbit Polyclonal Anti-ESRRB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody,clone OTI12B7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody,clone OTI12B7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody,clone OTI12B7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody,clone OTI12B7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody,clone OTI12B7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |