Products

Jump to Filters
View as table Download
Galanin (GAL) Goat Polyclonal Antibody
TA311451

USD 375.00

2 Weeks

Goat Anti-GAL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HRSFSDKNGLTSK, from the internal region of the protein sequence according to NP_057057.2.
Galanin (GAL) Rabbit Polyclonal Antibody
TA330441

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
Galanin (GAL) Mouse Monoclonal Antibody [Clone ID: 4B3]
TA385997

USD 523.00

2 Weeks

Recombinant Anti-Galanin (Clone 4B3)

Applications ELISA, ICC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.