Products

Jump to Filters
View as table Download
CHI3L1 Rabbit Polyclonal Antibody
TA340002

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHI3L1 Antibody

Applications IF, WB
Reactivities Human, SimianIVE
Conjugation Unconjugated
Immunogen The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL