CHI3L1 Rabbit Polyclonal Antibody

CAT#: TA340002

Rabbit Polyclonal Anti-CHI3L1 Antibody

Product Images

WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  simian immunodeficiency virus encephalitis

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, SimianIVE
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: chitinase 3 like 1
• Database Link:
  NP_001267
  Entrez Gene 1116 Human
  UniProt ID P36222
• Background: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
• Synonyms: ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; hCGP-39; YKL-40; YKL40; YYL-40
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 92%; Goat: 92%; Bovine: 92%; Dog: 77%; Rat: 77%

Reference Data

• Protein Families: Secreted Protein