Products

View as table Download

Rabbit Polyclonal Anti-L2HGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L2HGDH antibody is: synthetic peptide directed towards the middle region of Human L2HGDH. Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG

L2HGDH (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 139-167aa) of human L2HGDH/Duranin.

L2HGDH Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human L2HGDH (NP_079160.1).
Modifications Unmodified

L2HGDH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human L2HGDH (NP_079160.1).
Modifications Unmodified