L2HGDH Rabbit Polyclonal Antibody

CAT#: TA337982

Rabbit Polyclonal Anti-L2HGDH Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "L2HGDH"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-L2HGDH antibody is: synthetic peptide directed towards the middle region of Human L2HGDH. Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name L-2-hydroxyglutarate dehydrogenase
Background This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe mental retardation.
Synonyms C14orf160; L2HGA
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 91%; Dog: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Pathways Butanoate metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.