Products

View as table Download

Rabbit polyclonal anti-ARHGEF1 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1.

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG

ARHGEF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF1

ARHGEF1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 783-912 of human ARHGEF1 (NP_004697.2).
Modifications Unmodified