Products

View as table Download

Rabbit Polyclonal Anti-CD83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD83 Antibody: A synthesized peptide derived from human CD83

Anti-CD83 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 20-144 amino acids of human CD83 molecule

Rabbit Polyclonal Anti-CD83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD83 antibody is: synthetic peptide directed towards the C-terminal region of Human CD83. Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV

CD83 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of human CD83 (NP_004224.1).
Modifications Unmodified