Products

View as table Download

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Rabbit polyclonal CDC2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDC2.

Rabbit Polyclonal Anti-CDC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Rabbit Polyclonal Anti-CDC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP

Rabbit Polyclonal CDC2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC2

Rabbit Polyclonal CDC2 (Tyr15) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC2 around the phosphorylation site of Tyrosine 15
Modifications Phospho-specific

Rabbit polyclonal CDC2 (Ab-161) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Threonine161.

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

CDK1 mouse monoclonal antibody, clone IMD-34, Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.

Rabbit Polyclonal Antibody against CDC2 (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CDC2.

Rabbit Polyclonal Anti-CDK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the N terminal of human CDC2. Synthetic peptide located within the following region: EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIRE

CDK1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CDK1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against CDC2 (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2.

Rabbit Anti-cdc2 (Tyr15) Antibody (Phospho-Specific)

Applications WB
Reactivities Human, Xenopus
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Tyr15 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-CDK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT

Phospho-CDK1-Y15 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y15 of human CDK1
Modifications Phospho-specific

Anti-CDK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1

CDK1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDK1

CDK1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-297 of human CDK1 (NP_001777.1).
Modifications Unmodified

CDK1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1).
Modifications Unmodified

CDK1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1).
Modifications Unmodified

Phospho-CDK1-T14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T14 of human CDK1 (NP_001777.1).
Modifications Phospho T14

Phospho-CDK1-Y15 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y15 of human CDK1 (NP_001777.1).
Modifications Phospho Y15

CDK1 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated

Anti-Cdk1 (N-terminal region) Antibody

Applications ICC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-Cdk1 (Tyr-15) [conserved site], Phosphospecific Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated