Rabbit Polyclonal Anti-Chmp4c Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Chmp4c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Chmp4c. Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA |
Rabbit polyclonal CHMP4C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from C terminal of Human CHMP4C. |
Rabbit polyclonal CHMP4C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from C terminal of Human CHMP4C. |
Germany
Japan
United Kingdom
China