Products

View as table Download

Goat Anti-CTLA + CTLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDFNPKSSKQAKD, from the internal region of the protein sequence according to NP_001824.1; NP_009027.1; NP_001070145.1; NP_001825.1; NP_009028.1.

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLTA antibody: synthetic peptide directed towards the C terminal of human CLTA. Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clta antibody is: synthetic peptide directed towards the C-terminal region of Rat Clta. Synthetic peptide located within the following region: EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS

Carrier-free (BSA/glycerol-free) CLTA mouse monoclonal antibody,clone OTI2D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CLTA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human CLTA (NP_001824.1).
Modifications Unmodified

CLTA mouse monoclonal antibody,clone OTI2D12, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin