Products

View as table Download

Rabbit polyclonal CNOT2 (Ab-101) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).

Rabbit Polyclonal Anti-CNOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

Rabbit Polyclonal Anti-CNOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS

Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 341-540 of human CNOT2 (NP_055330.1).
Modifications Unmodified

CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated