Rabbit polyclonal anti-CREB3L2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREB3L2. |
Rabbit polyclonal anti-CREB3L2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREB3L2. |
Rabbit Polyclonal Anti-CREB3L2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
Goat Polyclonal Anti-CREB3L2 / BBF2H7 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | internal region of NP_919047.2 (HSLQEPYTASVVRS) |
Rabbit polyclonal CREB3L2 Antibody (C-term)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CREB3L2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 490-517 amino acids from the C-terminal region of human CREB3L2. |
CREB3L2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CREB3L2 |
CREB3L2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
CREB3L2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-247 of human CREB3L2 (NP_001240704.1). |
Modifications | Unmodified |