Germany
Japan
United Kingdom
China
CREB3L2 (Myc-DDK-tagged)-Human cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CREB3L2 (Myc-DDK tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CREB3L2 (mGFP-tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Creb3l2 (Myc-DDK-tagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CREB3L2 (GFP-tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CREB3L2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN411063 is the updated version of KN211063.
Creb3l2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503808 is the updated version of KN303808.
Creb3l2 (GFP-tagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Creb3l2 (Myc-DDK-tagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Creb3l2 (Myc-DDK-tagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Creb3l2 (mGFP-tagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Creb3l2 (GFP-tagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CREB3L2 (Myc-DDK tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CREB3L2 (mGFP-tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CREB3L2 (Myc-DDK tagged) - Homo sapiens cAMP responsive element binding protein 3-like 2 (CREB3L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CREB3L2 (GFP-tagged) - Homo sapiens cAMP responsive element binding protein 3-like 2 (CREB3L2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Creb3l2 (Myc-DDK-tagged ORF) - Rat cAMP responsive element binding protein 3-like 2 (Creb3l2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Creb3l2 (Myc-DDK-tagged ORF) - Rat cAMP responsive element binding protein 3-like 2 (Creb3l2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Creb3l2 (Myc-DDK-tagged ORF) - Rat cAMP responsive element binding protein 3-like 2 (Creb3l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Creb3l2 (mGFP-tagged ORF) - Rat cAMP responsive element binding protein 3-like 2 (Creb3l2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Creb3l2 (GFP-tagged ORF) - Rat cAMP responsive element binding protein 3-like 2 (Creb3l2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Creb3l2 (untagged) - Mouse cAMP responsive element binding protein 3-like 2 (Creb3l2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CREB3L2 (untagged)-Human cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CREB3L2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal anti-CREB3L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREB3L2. |
CREB3L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CREB3L2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
Goat Polyclonal Anti-CREB3L2 / BBF2H7 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_919047.2 (HSLQEPYTASVVRS) |
Rabbit polyclonal CREB3L2 Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CREB3L2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 490-517 amino acids from the C-terminal region of human CREB3L2. |
Creb3l2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
CREB3L2 (1-378, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CREB3L2 (1-378, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
CREB3L2 CRISPRa kit - CRISPR gene activation of human cAMP responsive element binding protein 3 like 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Creb3l2 CRISPRa kit - CRISPR gene activation of mouse cAMP responsive element binding protein 3-like 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene CREB3L2
qSTAR qPCR primer pairs against Mus musculus gene Creb3l2
Creb3l2 (untagged ORF) - Rat cAMP responsive element binding protein 3-like 2 (Creb3l2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CREB3L2 (untagged) - Homo sapiens cAMP responsive element binding protein 3-like 2 (CREB3L2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Creb3l2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Creb3l2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CREB3L2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CREB3L2 |
CREB3L2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CREB3L2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-247 of human CREB3L2 (NP_001240704.1). |
| Modifications | Unmodified |
Transient overexpression of CREB3L2 (NM_194071) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- CREB3L2