Products

View as table Download

Rabbit polyclonal Cytochrome P450 2R1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1.

Mouse monoclonal Anti-Cytochrome P450 2R1 Clone M26P6H1

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-CYP2R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2R1 antibody: synthetic peptide directed towards the middle region of human CYP2R1. Synthetic peptide located within the following region: FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL

Rabbit Polyclonal Anti-CYP2R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP2R1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2R1. Synthetic peptide located within the following region: ALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLG

CYP2R1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 252-501 of human CYP2R1 (NP_078790.2).
Modifications Unmodified