Germany
Japan
United Kingdom
China
CYP2R1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CYP2R1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP2R1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Cyp2r1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CYP2R1 (GFP-tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP2R1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN411200 is the updated version of KN211200.
Cyp2r1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504147 is the updated version of KN304147.
Cyp2r1 (GFP-tagged) - Mouse cytochrome P450 family 2 subfamily r polypeptide 1 (Cyp2r1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cyp2r1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp2r1 (Myc-DDK-tagged) - Mouse cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cyp2r1 (mGFP-tagged) - Mouse cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp2r1 (GFP-tagged) - Mouse cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2R1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2R1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cyp2r1 (Myc-DDK-tagged ORF) - Rat cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cyp2r1 (Myc-DDK-tagged ORF) - Rat cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp2r1 (Myc-DDK-tagged ORF) - Rat cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cyp2r1 (mGFP-tagged ORF) - Rat cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cyp2r1 (GFP-tagged ORF) - Rat cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CYP2R1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP2R1 (untagged)-Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2R1 antibody: synthetic peptide directed towards the middle region of human CYP2R1. Synthetic peptide located within the following region: FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL |
Rabbit Polyclonal Anti-CYP2R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYP2R1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2R1. Synthetic peptide located within the following region: ALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLG |
CYP2R1 CRISPRa kit - CRISPR gene activation of human cytochrome P450 family 2 subfamily R member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cyp2r1 CRISPRa kit - CRISPR gene activation of mouse cytochrome P450, family 2, subfamily r, polypeptide 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CYP2R1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CYP2R1
Cyp2r1 (untagged) - Mouse cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Cyp2r1
CYP2R1 MS Standard C13 and N15-labeled recombinant protein (NP_078790)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Cyp2r1 (untagged ORF) - Rat cytochrome P450, family 2, subfamily r, polypeptide 1 (Cyp2r1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of cytochrome P450 family 2 subfamily R polypeptide 1 (CYP2R1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CYP2R1 (untagged)-Human cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CYP2R1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cyp2r1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
CYP2R1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP2R1 |
CYP2R1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 252-501 of human CYP2R1 (NP_078790.2). |
| Modifications | Unmodified |
Transient overexpression of CYP2R1 (NM_024514) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CYP2R1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
CYP2R1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Cyp2r1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- CYP2R1