Products

View as table Download

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT

DPP6 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse DPP6

DPP6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 117-210 of human DPP6 (NP_001277182.1).
Modifications Unmodified