Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CPEAIMSLVGVLRRLAACREHQRAPEVYVAFTVRNPETCQLFTTELGRAG |
Germany
Japan
United Kingdom
China