FAM86A (EEF2KMT) Rabbit Polyclonal Antibody

CAT#: TA335332

Rabbit Polyclonal Anti-FAM86A Antibody

Product Images

Host: Rabbit; Target Name: FAM86A; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Guinea Pig, Human, Rat, Dog, Horse, Cow
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: eukaryotic elongation factor 2 lysine methyltransferase
• Database Link:
  NP_963892
  Entrez Gene 302931 RatEntrez Gene 100855633 DogEntrez Gene 196483 Human
  UniProt ID Q96G04
• Background: The function of this protein remains unknown.
• Synonyms: eEF2-KMT; FAM86A; SB153
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Dog: 82%; Pig: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%