Products

Jump to Filters
View as table Download
Fam107b Rabbit Polyclonal Antibody
TA332252

USD 375.00

5 Days

Rabbit Polyclonal Anti-Fam107b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fam107b Antibody is: synthetic peptide directed towards the middle region of Rat Fam107b. Synthetic peptide located within the following region: PELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK