Products

View as table Download

Rabbit Polyclonal Anti-FBXO17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FBXO17 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO17. Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA

Rabbit Polyclonal FBG4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide contianing residues 70-85 (LQLARDRSAEGRALYA) of the human FBG4 protein. There is 100% sequence identity between the immunogen and mouse and rat sequences.