Products

cDNA Clones (34)
Proteins (13)
RNAi (12)
Gene Expression (6)
Antibodies (2)
Jump to Filters
View as table Download
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996

USD 420.00

In Stock

FBXO17 (Myc-DDK-tagged)-Human F-box protein 17 (FBXO17), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO17 (NM_024907) Human Tagged ORF Clone
RC202158

USD 420.00

In Stock

FBXO17 (Myc-DDK-tagged)-Human F-box protein 17 (FBXO17), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L1V

USD 820.00

3 Weeks

Lenti ORF particles, FBXO17 (Myc-DDK tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L2V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO17 (mGFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Fbxo17 (NM_015796) Mouse Tagged ORF Clone
MR203902

USD 300.00

In Stock

Fbxo17 (Myc-DDK-tagged) - Mouse F-box protein 17 (Fbxo17)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO17 (NM_024907) Human Tagged ORF Clone
RG202158

USD 460.00

In Stock

FBXO17 (GFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO17 Human Gene Knockout Kit (CRISPR)
KN402158

USD 1,290.00

2 Weeks

FBXO17 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402158 is the updated version of KN202158.
Fbxo17 Mouse Gene Knockout Kit (CRISPR)
KN505807

USD 1,290.00

2 Weeks

Fbxo17 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN505807 is the updated version of KN305807.
Fbxo17 (BC026470) Mouse Tagged ORF Clone
MG203902

USD 330.00

3 Weeks

Fbxo17 (GFP-tagged) - Mouse F-box protein 17 (cDNA clone MGC:31493 IMAGE:4486850)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fbxo17 (NM_015796) Mouse Tagged ORF Clone
MR203902L3

USD 500.00

3 Weeks

Lenti ORF clone of Fbxo17 (Myc-DDK-tagged) - Mouse F-box protein 17 (Fbxo17)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fbxo17 (NM_015796) Mouse Tagged ORF Clone
MR203902L4

USD 500.00

3 Weeks

Lenti ORF clone of Fbxo17 (mGFP-tagged) - Mouse F-box protein 17 (Fbxo17)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone
RC202158L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone Lentiviral Particle
RC202158L3V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO17 (Myc-DDK tagged) - Human F-box protein 17 (FBXO17), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone
RC202158L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_024907) Human Tagged ORF Clone Lentiviral Particle
RC202158L4V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO17 (mGFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L3V

USD 820.00

7 Weeks

Lenti ORF particles, FBXO17 (Myc-DDK tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone Lentiviral Particle
RC222996L4V

USD 820.00

7 Weeks

Lenti ORF particles, FBXO17 (mGFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 (NM_148169) Human Tagged ORF Clone
RG222996

USD 460.00

3 Weeks

FBXO17 (GFP-tagged) - Human F-box protein 17 (FBXO17), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fbxo17 (NM_001013064) Rat Tagged ORF Clone
RR206465

USD 420.00

4 Weeks

Fbxo17 (Myc-DDK-tagged ORF) - Rat F-box protein 17 (Fbxo17), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Fbxo17 (NM_001013064) Rat Tagged ORF Clone
RR206465L3

USD 640.00

9 Weeks

Lenti ORF clone of Fbxo17 (Myc-DDK-tagged ORF) - Rat F-box protein 17 (Fbxo17), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fbxo17 (NM_001013064) Rat Tagged ORF Clone
RR206465L4

USD 700.00

9 Weeks

Lenti ORF clone of Fbxo17 (mGFP-tagged ORF) - Rat F-box protein 17 (Fbxo17), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO17 Rabbit Polyclonal Antibody
TA331636

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXO17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FBXO17 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO17. Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L1

USD 768.00

In Stock

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FBXO17 Rabbit Polyclonal Antibody
TA309659

USD 350.00

2 Weeks

Rabbit Polyclonal FBG4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide contianing residues 70-85 (LQLARDRSAEGRALYA) of the human FBG4 protein. There is 100% sequence identity between the immunogen and mouse and rat sequences.
FBXO17 (NM_148169) Human Tagged ORF Clone
RC222996L2

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 17 (FBXO17), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FBXO17 Human siRNA Oligo Duplex (Locus ID 115290)
SR314498

USD 430.00

In Stock

FBXO17 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

FBXO17 (NM_024907) Human Recombinant Protein
TP760528

USD 215.00

In Stock

Purified recombinant protein of Human F-box protein 17 (FBXO17), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
FBXO17 (NM_148169) Human Over-expression Lysate
LC407767

USD 121.00

In Stock

FBXO17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_024907) Human Untagged Clone
SC323757

USD 660.00

In Stock

FBXO17 (untagged)-Human F-box protein 17 (FBXO17), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Fbxo17 Mouse shRNA Plasmid (Locus ID 50760)
TL502827

USD 815.00

In Stock

Fbxo17 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Fbxo17 Mouse shRNA Lentiviral Particle (Locus ID 50760)
TL502827V

USD 1,395.00

3 Weeks

Fbxo17 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Human FBXO17 activation kit by CRISPRa
GA114518

USD 1,290.00

2 Weeks

FBXO17 CRISPRa kit - CRISPR gene activation of human F-box protein 17

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Fbxo17 activation kit by CRISPRa
GA205344

USD 1,290.00

2 Weeks

Fbxo17 CRISPRa kit - CRISPR gene activation of mouse F-box protein 17

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
FBXO17 Human qPCR Primer Pair (NM_148169)
HP228399

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene FBXO17

FBXO17 (NM_024907) Human Over-expression Lysate
LC411006

USD 121.00

2 Weeks

FBXO17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Over-expression Lysate
LC430185

USD 121.00

2 Weeks

FBXO17 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Over-expression Lysate
LY407767

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 17 (FBXO17), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY407767 is the same product as LY430185.
FBXO17 (NM_024907) Human Over-expression Lysate
LY411006

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 17 (FBXO17), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO17 (NM_148169) Human Over-expression Lysate
LY430185

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 17 (FBXO17), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Fbxo17 (NM_015796) Mouse Untagged Clone
MC209863

USD 420.00

4 Weeks

Fbxo17 (untagged) - Mouse F-box protein 17 (Fbxo17), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Fbxo17 Mouse qPCR Primer Pair (NM_015796)
MP204702

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Fbxo17

Fbxo17 (NM_001013064) Rat Untagged Clone
RN206465

USD 420.00

5 Weeks

Fbxo17 (untagged ORF) - Rat F-box protein 17 (Fbxo17), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO17 (NM_148169) Human 3' UTR Clone
SC213172

USD 560.00

4 Weeks

3`UTR clone of F-box protein 17 (FBXO17) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
FBXO17 (NM_024907) Human 3' UTR Clone
SC213173

USD 560.00

4 Weeks

3`UTR clone of F-box protein 17 (FBXO17) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase