Products

View as table Download

GART mouse monoclonal antibody, clone 4D6-1D5

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-GART Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV

GART Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human GART (NP_000810.1).
Modifications Unmodified