Products

View as table Download

GLUD1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Glutamate Dehydrogenase (Bovine Liver).

GLUD1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Glutamate Dehydrogenase (Bovine Liver).

GLUD1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen L-Glutamate Dehydrogenase isolated and purified from Bovine Liver.

GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2.

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

GLUD1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLUD1

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF

GLUD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLUD1

GLUD1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 54-240 of human GLUD1 (NP_005262.1).
Modifications Unmodified