Germany
Japan
United Kingdom
China
Products
View as table Download
IRF5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IRF5 |
Rabbit polyclonal IRF5 Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IRF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-108 amino acids from the N-terminal region of human IRF5. |
Rabbit polyclonal anti-IRF5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human IRF5. |
Rabbit Polyclonal Anti-IRF5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the middle region of human IRF5. Synthetic peptide located within the following region: IFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQ |
Rabbit Polyclonal Anti-IRF5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRF5 Antibody: synthetic peptide directed towards the N terminal of human IRF5. Synthetic peptide located within the following region: PTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQD |
Rabbit Polyclonal Anti-IRF5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the N terminal of mouse IRF5. Synthetic peptide located within the following region: CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAP |
Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IRF5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2). |
| Modifications | Unmodified |
IRF5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2). |
| Modifications | Unmodified |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IRF5
Applications
- WB