Products

Jump to Filters
View as table Download
PRPF38B Rabbit Polyclonal Antibody
TA331873

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRPF38B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRPF38B Antibody is: synthetic peptide directed towards the middle region of Human PRPF38B. Synthetic peptide located within the following region: VQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG