Germany
Japan
United Kingdom
China
Prpf38b (Myc-DDK-tagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadPRPF38B (Myc-DDK-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRPF38B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN423346 is the updated version of KN223346.
Prpf38b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513970 is the updated version of KN313970.
Prpf38b (GFP-tagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prpf38b (Myc-DDK-tagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf38b (Myc-DDK-tagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prpf38b (mGFP-tagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf38b (GFP-tagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PRPF38B (Myc-DDK-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRPF38B (Myc-DDK-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PRPF38B (mGFP-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRPF38B (mGFP-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRPF38B (GFP-tagged) - Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Prpf38b (Myc-DDK-tagged ORF) - Rat PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prpf38b (Myc-DDK-tagged ORF) - Rat PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf38b (Myc-DDK-tagged ORF) - Rat PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prpf38b (mGFP-tagged ORF) - Rat PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prpf38b (GFP-tagged ORF) - Rat PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-PRPF38B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRPF38B Antibody is: synthetic peptide directed towards the middle region of Human PRPF38B. Synthetic peptide located within the following region: VQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG |
PRPF38B CRISPRa kit - CRISPR gene activation of human pre-mRNA processing factor 38B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Prpf38b CRISPRa kit - CRISPR gene activation of mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PRPF38B
Prpf38b (untagged) - Mouse PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Prpf38b
Prpf38b (untagged ORF) - Rat PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (Prpf38b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PRPF38B (untagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRPF38B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Prpf38b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Prpf38b (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of PRPF38B (NM_018061) in HEK293T cells paraffin embedded controls for ICC/IHC staining
PRPF38B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
PRPF38B - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Prpf38b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Prpf38b - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Prpf38b - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Prpf38b - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
PRPF38B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Prpf38b - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Prpf38b - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of PRPF38B (NM_018061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRPF38B (NM_018061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PRPF38B