Products

View as table Download

LOC105369264 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 185-215aa) of human PTPN20A.

Rabbit Polyclonal Anti-PTPN20B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTPN20B Antibody is: synthetic peptide directed towards the N-terminal region of Human PTPN20B. Synthetic peptide located within the following region: ETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGS

Rabbit Polyclonal Anti-PTPN20B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPN20B