Products

View as table Download

Rabbit polyclonal Anti-SCN3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

SCN3B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-160 of human SCN3B (NP_060870.1).
Modifications Unmodified