Products

Jump to Filters
View as table Download
SCN3B Rabbit Polyclonal Antibody
TA331466

USD 375.00

5 Days

Rabbit polyclonal Anti-SCN3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
SCN3B Rabbit Polyclonal Antibody
TA381291

USD 220.00

3 Weeks

SCN3B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-160 of human SCN3B (NP_060870.1).
Modifications Unmodified