Products

Jump to Filters
View as table Download
Oprm1 Rabbit Polyclonal Antibody
TA338333

USD 375.00

In Stock

Rabbit Polyclonal Anti-Oprm1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV