Products

View as table Download

GRK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GRK1

Rabbit polyclonal GRK1 (Ab-21) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GRK1 around the phosphorylation site of serine 21 (R-G-SP-F-D)

GRK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-GRK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK1 antibody: synthetic peptide directed towards the middle region of human GRK1. Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR

Anti-GRK1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-35 amino acids of Human G protein-coupled receptor kinase 1

GRK1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRK1

GRK1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human GRK1 (NP_002920.1).
Modifications Unmodified