Rabbit Polyclonal Antibody against CLIC4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CLIC4 antibody is generated from rabbits immunized with recombinant human CLIC4 protein. |
Rabbit Polyclonal Antibody against CLIC4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CLIC4 antibody is generated from rabbits immunized with recombinant human CLIC4 protein. |
Rabbit polyclonal CLIC4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4. |
Rabbit Polyclonal Anti-CLIC4
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)NGLKEEDKEPLIE, corresponding to amino acid residues 8 - 20 of human CLIC4. Intracellular, N-terminus. |
Goat Polyclonal Antibody against CLIC4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NGLKEEDKEPLIE-C, from the N Terminus of the protein sequence according to NP_039234.1. |
Rabbit Polyclonal Anti-CLIC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF |
Rabbit Polyclonal Anti-CLIC4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLIC4 |