Products

View as table Download

Rabbit Polyclonal Anti-KCNIP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL

KCNIP4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 9-39 amino acids from the N-terminal region of human KCNIP4.

Rabbit Polyclonal Anti-KCNIP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSP

Rabbit Polyclonal Anti-KCNIP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL

Rabbit Polyclonal Anti-KCNIP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSP